Produkter

0 Forord

Sideløbende med udviklingen i dansk pelsdyrproduktion har det veterinære virkefelt inden for pelsdyrsygdomme også udviklet sig betydeligt. Danmark er verdens største producent af mink, og uanset hvilket job du får som færdiguddannet dyrlæge her i landet, kan du blive konfronteret med spørgsmål om pelsdyr. Både hos danske myndigheder, dyrlæger og i erhvervet er der stigende fokus på velfærd og sundhed i minkproduktionen. Der blev således i 2011 indført obligatorisk sundhedsrådgivning på danske minkgårde. Ordningen samt stramninger i lovgivningen generelt betyder, at der stilles større krav til dyrlægers og konsulenters kompetencer. Det betyder også, at antallet af praktiserende dyrlæger i Danmark, som arbejder med mink, er steget. Det er imidlertid en stor udfordring for de praktiserende dyrlæger, der arbejder med mink, at der er meget lidt tilgængelig litteratur til rådighed på området, og de få bøger, man kan finde om minksygdomme, er skrevet for mere end 20 år siden. I de mellemliggende år er nye sygdomme kommet til, og andre sygdomsproblemer har i dag mindre betydning end før. Som titlen på denne bog antyder, har det været vores hensigt at skrive om syge mink, men i allerhøjeste grad også om sundhed hos mink. Det er vores opfattelse, at der i dag er et højt sundhedsmæssigt niveau på danske minkgårde, og det er dyrlægernes og avlernes ansvar at sørge for, at dette niveau kontinuerligt opretholdes og optimeres. Vi er ikke i tvivl om, at det virker bedre at forebygge sygdomsmæssige problemer hos mink end at behandle dem, når de først er opstået. Derfor har vi også lagt stor vægt på at beskrive mulighederne for forebyggelse og smittebeskyttelse. Det sker dels i bogens første del, der består af enkeltafsnit om de forskellige sygdomme hos mink og dels i bogens anden del som handler om sundhedsrådgivning. Sygdomsafsnittene gennemgår både velkendte og nye minksygdomme. Omfang og indhold af disse afsnit varierer afhængig af, hvor meget viden der findes om sygdommenes udbredelse, symptomer, patologi, ætiologi samt om forebyggelse og behandling. Det er hensigten, at afsnittene fremadrettet kan udbygges og opdateres, efterhånden som ny viden bliver tilgængelig. Sundhedsrådgivningsdelen omhandler driftsmæssige forhold på minkgårde, som har indflydelse på minkenes sundhed og produktion. Herunder er nævnt enkelte andre emner, som den rådgivende dyrlæge kan få brug for i sit virke på minkgårdene. De enkelte emner er beskrevet på en form og niveau, som kan introducere studerende eller nyuddannede dyrlæger til driften på en minkgård. Behandlingsafsnittet er holdt i mere principielle termer, medicin og doserings forslag er kun angivet, hvor der er tale om godkendte midler. I de afsnit, hvor der findes relevant lovgivning om emnet, er de væsentligste dele af denne lovgivning omhandlende minkproduktion medtaget. Lovgivningen vil blive ændret over tid, men forfatterne har vurderet, at den dags dato gældende er relevant viden. Mange af de sygdomme, der forekommer i pelsdyrproduktionen i dag, er komplekse og multifaktorielle af natur. Derfor har det også under udarbejdelsen af bogen været en stor fordel, at forfatternes viden og kompetencer stammer fra vidt forskellige tilgange til arbejdet med pelsdyrsygdomme. Anne Sofie Hammer har erfaring i arbejde med minkens patologi og med udvikling af laboratoriediagnostik, Peder Elbek har erfaring fra veterinærpraksis og rådgivning, samt lovgivning p&a

0.1 Minksygdomme – kalender

Minksygdomme – kalender Som følge af, at minken er sæsonbestemt monocyklisk, følger sygdomsforekomst på minkgårde som regel et udtalt sæsonafhængigt mønster. Minkens avls- og vækstsæson følger det samme mønster år efter år, styret primært af dagslængden og lys. De sygdomme, vi ser på minkgårdene i løbet af året, er ofte knyttet til minkens livscyklus. I april og begyndelsen af maj forekommer sygdomme relateret til fødsler og post partum periode. I maj og juni ses sygdomme i tilknytning til diegivning og senere til hvalpenes overgang fra mælk til fast foder. I vækstsæson fra juli til oktober vokser minkene hurtigt og der kan ses sygdomme af metabolisk karakter (eksempelvis fedtlever). Alvorlige infektionssygdomme som plasmacytose, hvalpesyge og parvo virusenteris kan ramme minkgården hele året, men med forskellig konsekvens afhængig af, hvornår smitten introduceres på minkgården. Spredning i besætningen, symptombillede og dødelighed påvirkes af hvad tid på året sygdommen rammer og dermed hvilken alderssammensætning og dyretæthed der er i besætningen. Der vil kunne forekomme skader og sårinfektioner hele året. Omkring fravænningstidspunktet og i forbindelse med hormonelle ændringer i efteråret (kønsmodning initieres af aftagene dagslængde i efteråret) kan forekomme en øgning i skader forårsaget af andre mink. I parringsperioden er dyrene mere aktive og bliver håndteret mere, hvilket kan være årsag til stress. I denne periode ses størst forekomst af nekrotiserende pyodermi (FENP) og sår som følge af afrevne potekallus. Nogen foderbårne sygdomme kan ses på alle tidspunkter på året. Men de unge dyr i vækstperioden (i sær hanhvalpene der har det relativt højeste foderindtag) vil ofte være mere disponerede for foderbårne infektioner og forgiftningerne i denne periode. Botulisme og diverse infektionssygdomme kan udløses af råvarer af dårlig kvalitet. Foderbårne infektioner kan forekomme hele året, men for nogen agens er der et vindue, hvor minken er mere modtagelig. Det gælder eksempelvis infektioner med Clostridium limosum og salmonella som ses i drægtige tæver og clostridieinfektioner hos minkhvalpe i tandskifte. Lopper lever af og ved minkene hele året, men er især i diegivningsperioden og ved pelsning til stor gene for dyr og mandskab. Skemaet viser sæsonforekomst af udvalgte minksygdomme:

1.1 Clostridieinfektioner hos mink

Clostridieinfektioner hos mink af Anne Sofie Hammer, Peder Elbek og Tove Clausen Forekomst, betydning og ætiologi Der er meget få tilgængelige beskrivelser af clostridieinfektioner hos mink. Der er i de seneste år registreret udbrud forårsaget af Clostridium septicum infektioner hos minkhvalpe i forbindelse med tandskifte. Da flere minkgårde med udbrud var tilknyttet samme foderproducent, har man haft en mistanke om foderbåren sygdom. Cl. carnis-lignende organismer, Cl. oedematiens og Cl. charvoi, er også beskrevet i forbindelse med foderrelateret sygdom. Cl. perfringens er isoleret fra tarmen hos mink med diarre og beskrevet som årsag til enterotoxicose (associeret med rå, ubehandlede råvarer. Da Cl. perfringens imidlertid ofte isoleres fra tarmen hos raske mink, er betydningen imidlertid uklar. Cl. limosum er beskrevet i forbindelse med aborter og livmoderinfektioner hos hunmink (se afsnit vedrørende Cl. limosum endometritis). Symptomer og patologi Der er kun få rapporter, som beskriver clostridieinfektioner hos mink. Typisk beskriver disse rapporter foderrelateret sygdom karakteriseret af pludselige dødsfald. I tabel 1 beskrives symptomer og patologi rapporteret for forskellige typer af clostridier. Tabel 1. Symptomer og patologi beskrevet for clostridieinfektioner hos mink. Agens Symptomer Patologi Clostridum septicum Pludselige dødsfald, svulne hoveder Ødem og gasproduktion i subkutane væv i hovedregionen. Forekomst ved tandskifte. Clostridium carnis Pludselige dødsfald Ikterus, petechiale blødninger i leveren, svulne nyrer med talrige subkapsulære petechiale blødninger Clostridium charvoi Pludselige dødsfald, høj dødelighed, tab af appetit, koma Ødem og stase i subkutane væv, ødem og gasbobler i bagkroppens muskulatur, forstørret milt og enteritis Clostridium perfringens Pludselige dødsfald, diarre Enteritis Clostridium limosum Pludselige dødsfald blandt drægtige hunmink, aborter. blodigt flåd fra kønsåbningen. Opløsning af uterusvævet, hvor fostre og nedbrudt uterusvæv flyder ud i bughulen. Nogen gange kan ses gasbobler i uterusvævet. Nogen gange ses enteritis. Diagnostik Clostridium spp. kan påvises ved anaerob dyrkning. Differentialdiagnostik Infektioner med Cl. septicum infektioner kan forveksles med andre årsager til ”svulne hoveder”, herunder tandbylder og eosinofil myositis. Forebyggelse og behandling Ofte forekommer dødsfald pludseligt med kun kortvarige eller ingen symptomer forud for dødsfaldet. Behandling når i disse tilfælde ikke at blive relevant. Antimikrobiel behandling kan forsøges. Infektion med clostridier er blevet associeret med foder kontamineret af dyr, der er døde, eller som har været bærere af bakterierne, samt uhensigtsmæssig håndtering af råvarer. Omhyggelig selektion af råvarer og rengøring af udstyr, der kommer i kontakt med foderet, er en vigtig del af forebyggelse af infektion med clostridier. Forebyggelsen består i, så vidt det er muligt, at undgå patogene typer af clostridier i råvarer og foder. I nogle typer af råvarer vil der altid være clostridier til stede. Det gælder typisk råvarer, der indeholder tarm fra andre dyrearter. Da mange arter af clostridier er sporedannende, er varmebehandling ikke tilstrækkeligt til at fjerne risiko for infektion.&

1.2 Clostridium limosum endometritis hos mink

Clostridium limosum endometritis hos mink af Anne Sofie Hammer, Peder Elbek og Tove Clausen Forekomst og betydning I Danmark og flere andre nordiske lande har bakterien Clostridium limosum været associeret med aborter og dødsfald blandt hunmink sidst i april og i begyndelsen af maj. I 2014 blev der konstateret udbrud på mange minkgårde, der fik foder leveret fra den samme fodercentral. I dette tilfælde blev bakterien påvist i foderprøver og en råvare anvendt i foderet (fjerkræskrog). Ætiologi og patogenese Bakterien Cl. limosum er en obligat anaerob bakterie. Bakteriens patogenecitet er formodentlig forbundet med evnen til at producere collagenaser (enzymer, der nedbryder bindevæv). Symptomer Karakteristiske symptomer omfatter blodigt flåd fra ydre kønsveje, aborter og dødsfald. Patologi Karakteristiske patologiske fund var blodigt flåd fra ydre kønsåbning hos hunmink. Ved åbning af bughulen fandtes livmoderen delvist opløst. Livmodervævet var skrøbeligt og gik i stykker ved berøring. Døde hvalpe flød rundt i bughulen i rester af helt eller delvist opløst livmodervæv. Diagnostik Cl. limosum kan påvises ved anaerob dyrkning fra livmoderindholdet. Bakterien er langsomtvoksende (3-4 dage). I forbindelse med forskningsmæssige undersøgelser er udviklet en PCR metode til påvisning af Cl. Limosum i væv og foder. Differentialdiagnostik Den vigtigste differentialdiagnose er salmonellose. Forebyggelse og behandling Det har ved tidligere udbrud været tvivlsomt, om behandling (antimikrobielle midler) har haft nogen effekt. Dette kan skyldes, at sygdomsudbruddene optræder så akutte, at behandling ofte kommer for sent. Den bedste forebyggelse er at undgå råvarer forurenet med bakterien Cl. limosum i drægtighedsperioden. Figur 1. Hunmink med endometritis forårsaget af Clostridium limosum. De kliniske fund hos var manglende ædelyst og blodig væske fra kønsåbningen. Figur 1. Hunmink med endometritis forårsaget af Clostridium limosum. Ved åbning af bughulen findes livmoderen delvist opløst. Døde hvalpe flyder rundt i bughulen i rester af helt eller delvist opløst livmodervæv. Litteratur Biström M, Moisander-Jylhä AM, Heinikainen S, Pelkola K, Raunio-Saarnisto M. Isolation of Clostridium limosum from an outbreak of metritis in farmed mink. Acta Vet Scand. 2016. 6;58(1):49. Cato EP, Cummins CS, Smith DS. Clostridum limosum André in Prévot 1948,165 amended description and pathogenic characteristics. Int J SystBacteriol. 1970.20(3): 305-210. Hammer AS, Andresen L, Aalbæk B, Damborg P, Weiss V, Christiansen ML, Selsing S, Bahl MI. Abortion and mortality in farm mink (Neovison vison) associated with feed-born Clostridium limosum. Vet Microbiol. 2017. 203:229-233.

1.3 Endokarditis hos mink

Endokarditis hos mink af Anne Sofie Hammer, Peder Elbek og Tove Clausen Andre anvendte betegnelser Hjerteklapbetændelse. Forekomst og betydning Hjertelidelser er sjældne hos mink. Forekomsten af hjertelidelser ved rutinemæssige obduktioner af dødfundne og aflivede mink er formodentlig omkring 1 promille. Kronisk endokarditis med små nydannelser på hjerteklapperne påvises lejlighedsvist hos mink. Ætiologi og epidemiologi Infektion med Streptococcus spp. kan både forekomme som lejlighedsfund hos enkelte mink og som udbrud. Streptococcus bovis og Streptococcus suis har været relateret til flere formentlig foderrelaterede udbrud af endokarditis på minkgårde tilhørende samme foderproducenter. Symptomer Pludselige dødsfald uden forudgående symptomer. Patologi Hjertet hos mink er normalt ret stort og placeret caudalt i brysthulen. Ved endokarditis kan hjertet være endnu større. Ved åbning af hjertet kan der påvises kroniske verukøse forandringer på hjerteklapperne (endokarditis). Diagnostik Diagnosen stilles ved pato-anatomisk undersøgelse af hjertet. Differentialdiagnostik Andre sygdomme, der forårsager pludselige dødsfald uden forudgående symptomer (for eksempel smitsom lungebetændelse) Behandling og forebyggelse Endokarditis er ofte associeret med streptokokinfektioner og streptokokker. Penicillin er egnet til behandling af streptokokinfektioner. Bakterierne S. bovis og S. suis bør undgås i råvarer og foder, da begge bakterier har været associeret med foderrelaterede udbrud af verukøs endokarditis hos mink. Figur 1. Hjertet fra mink med endokarditis associeret med streptokokinfektion. Der er kroniske verukøse læsioner på hjerteklapperne. Litteratur Pedersen K, Jørgensen JC, Dietz HH, Andersen TH. Verrucous endocarditis associated with Streptococcus bovis in mink (Mustela vison). Vet Rec. 2003. 153(9):264-8. Lund A (red.). Mink – avl og opdræt. Nordisk håndbog for minkopdrættere. Det kgl. Danske Landhusholdningsselskab, København, Danmark. 1961.

1.4 Hvalpesyge hos mink

Hvalpesyge hos mink af Anne Sofie Hammer, Peder Elbek og Tove Clausen Andre anvendte betegnelser Distemper. Forekomst og betydning Hvalpesygevirus eller canine distemper virus (CDV) er et af de vigtigste infektiøse agens hos vilde og tamme rovdyr. Det er det samme virus, som forårsager hundesyge hos medlemmer af hundefamilien (eksempelvis hund, ræv, mårhund). CDV har et usædvanligt bredt værtsspektrum og kan blandt andet inficere en bred vifte af dyr, der tilhører hundefamilien (hund, ræv, ulv etc.), mårfamilien (fritter, mink, grævling etc.) og kattefamilien (tigre og løver). CDV er udbredt til hele verden og forårsager sygdomsudbrud med høj morbiditet og mortalitet i populationer af vildtlevende dyr og pelsdyr. Rapporteret mortalitet ved udbrud hos mink varierer mellem 1 pct. og mere end 80 pct. af dyrene på inficerede minkgårde. Mortaliteten er som regel størst blandt unge dyr. De første tilfælde af hvalpesyge i danske pelsdyrbesætninger blev konstateret i 1944. Siden har forekomsten af hvalpesyge varieret meget fra år til år – og der har været perioder, hvor udbrud slet ikke er blevet påvist gennem flere år. Vaccination af hunde og mink mod CDV menes at have været medvirkende til at nedbringe antallet af udbrud. Efter en periode med varierende antal hvalpesygeudbrud var der fra 2008 til 2010 en pause, hvor ingen hvalpesygetilfælde blev påvist, hverken på minkgårde eller i vildtlevende dyr i Danmark. I 2011 blev der igen påvist hvalpesyge på tre minkgårde, i 2012 og 2013 blev der påvist hvalpesygeudbrud på mere end 60 minkgårde i Jylland. Antallet af udbrud har i de efterfølgende år været lavt, formodentlig på grund af udbredt anvendelse af forebyggende vaccination. I samme periode er CDV påvist hos ræve i Danmark og Tyskland. Ætiologi CDV tilhører slægten Morbillivirus og familien Paramyxoviridae. Viruspartiklen er kappebærende og 150-300 nm i diameter. CDV har et lineært negativ-sense, enkeltstrenget RNA-genom, som koder for de følgende virusproteiner: matrix (M), fusion (F), hæmagglutinin (H), nucleocapsid (N), polymerase (L) og phosphoprotein (P). H-proteinet er et overfladeglycoprotein ansvarligt for binding til værtscellen, og det er et vigtigt mål for neutraliserende antistoffer. H-proteinet er det mest variable protein, og dermed er H-genet det gen, der oftest bruges til at undersøge genetisk udviklingen i CDV. CDV er ret skrøbeligt uden værten og inaktiveres hurtigt af ultraviolet lys (sollys), udtørring og temperaturer over 50°C. Overlevelsestiden i kadavere er relativt kort (mindre end 48 timer). Ved køletemperaturer (4°C) kan virus dog være stabilt i flere uger, og ved opbevaringstemperaturer på -65°C kan virus overleve i årevis. CDV inaktiveres af almindelige desinfektionsmidler. Patogenese Inkubationstiden for CDV er meget variabel, fra 1-4 uger og muligvis op til 6 måneder. Minkene smittes ved inhalation af aerosoldråber eller kontakt med væske fra øjne, respirationsveje eller mundhule på inficerede dyr. Andre mulige infektionsveje er transplacental og neonatal infektion. Den første virusreplikation sker i lymfatiske celler i de øvre luftveje. I løbet af få dage opformeres CDV i makrofager og spredes til tonsiller og regionale lymfeknuder. Efter en uge kan virus påvises i systemisk lymfatisk væv, samt tarmkanalens laminapropria og leverens Kupffer's stjerneceller. Virus opformeres herefter i respirationsvejsepitel, samt epitel i intestin

1.5 Hæmoragisk pneumoni hos mink forårsaget af colibakterier

Hæmoragisk pneumoni hos mink forårsaget af colibakterier af Anne Sofie Hammer, Peder Elbek og Tove Clausen Andre anvendte betegnelser: Coli-lungebetændelse, coli-pneumoni. Forekomst og betydning Akut hæmoragisk pneumoni forårsaget af Escherichia coli er blevet påvist med stigende hyppighed på danske minkgårde gennem de sidste 5-10 år. Årsagen til den stigende forekomst er ikke kendt, men mulige bidragende faktorer er: etablering af større minkgårde, etagebure med gruppeindhusning og derved større dyretæthed. E. coli er således blevet en stadig mere vigtig differentialdiagnose til hæmoragisk pneumoni forårsaget af infektion med Pseudomonas aeruginosa. Hæmoragisk lungebetændelse forbundet med E. coli forekommer ligesom P. aeruginosa pneumoni ofte i løbet af efterårsmånederne, men giver sjældent anledning til høj dødelighed. I de fleste tilfælde ses sporadisk og fåtallig forekomst i besætningen. Der er dog ved udbrud, hvor der samtidig er infektion med influenza set betydelig dødelighed. Ætiologi og epidemiologi E. coli er en gram negativ stavbakterie tilhørende familien Enterobacteriaceae.Den er katalase positiv, oxidase negativ og fakultativt anaerob, og den optimale væksttemperatur er 37oC. Colibakteriernes rolle som primær patogen hos mink er ikke dokumenteret. Pneumonier forårsaget af colibakterier hos andre arter associeres normalt med anden underliggende primær sygdomsårsag. Colibakterier er dog beskrevet som årsag til sjældne spontane fatale pneumonier hos hunde og katte og sjældent forekommende akut pneumoni hos immunkompetente mennesker. Der er i flere tilfælde påvist samtidig infektion med influenza ved udbrud af akut hæmoragisk pneumoni hos mink forårsaget af E. coli, og formodentlig har nogle pneumonier af denne type en primær viral ætiologi. Undersøgelser har vist, at både non-hæmolytiske og hæmolytiske stammer af E. coli er et normalt fund i tarmkanalen hos både raske mink og mink med diarré eller anden sygdom, og at antallet af disse bakterier i minkens tarmkanal varierer hos forskellige aldersgrupper af mink.I et studie af Tibbets et al fra 2003 blev 40 isolater, der var blevet associeret med hæmoragisk pneumoni og septikæmi hos mink i USA serotypet og undersøgt for tilstedeværelse af virulensgener og antibiotikaresistens. Talrige serogrupper blev fundet i forsøget med de mest hyppigt på viste værende O6 og O8. Næsten halvdelen af isolaterne bar gener for colicin,75 pct. producerede aerobaktin og alle producerede enterobaktin. De fleste isolater (83 pct.) var resistente for tetracyklin, og der sås varierende resistens for sulfamethoxazole, streptomycin, ampicillin, kanamycin, gentamicin, trimetroprim/sulfamethasol, chloramfenicol og nalidixin syre. Patologi De karakteristiske makroskopiske fund er akut hæmoragisk pneumoni. Der ses i reglen blodigt flåd fra næse og mund, blodtilblandet indhold i thorax, en eller flere mørkerøde atelektatiske lungelapper, hvor blod siver fra snitfladen, og blodtilblandet skummende indhold i trachea. Det er ikke muligt makroskopisk at skelne mellem pneumonier forårsaget af E. coli og P. aeruginosa. Histologiske fund i lungerne er karakteriseret af ved nekrose med meget begrænset inflammation, og fundene er meget ens for hæmoragisk pneumoni forårsaget af E. coli og P. aeruginosa, dog er der påvist mindre forskelle. Svært alveolært ødem og mild lymfoid infiltration forekommer oftere ved hæmoragisk pneumoni forårsaget af

1.6 Hæmoragisk pneumoni hos mink forårsaget af Pseudomonas aeruginosa

Hæmoragisk pneumoni hos mink forårsaget af Pseudomonas aeruginosa af Anne Sofie Hammer, Peder Elbek og Tove Clausen Andre anvendte betegnelser Smitsom lungebetændelse, pseudomonas pneumoni. Forekomst og betydning Pseudomonas aeruginosa blev første gang beskrevet som årsag til hæmoragisk pneumoni hos mink i 1953. Antallet af udbrud varierer fra år til år. Sygdommen er ikke lovomhandlet, og der foregår derfor ikke en egentlig officiel overvågning af forekomsten af udbrud. Uofficielle opgørelser baseret på diagnostiske indsendelser angiver, at der har været 8-50 udbrud årligt i de seneste 20 år. I Danmark påvises sygdommen næsten udelukkende i perioden fra september til begyndelsen af ​​december. Sygdommen har en meget varierende dødelighed, men kan potentielt være meget tabsvoldende med en dødelighed fra 1 pct. til 50 pct.. I ældre litteratur beskrives udbrud med 80-90 pct. dødelighed på minkgårde. Den lave dødelighed i dag skyldes formodentlig hurtig intervention, og at der som regel ikke er samtidig forekomst af andre infektionssygdomme, som kan komplicere kontrol af udbruddet, eksempelvis samtidig infektion med eksempelvis parvo virus. Ætiologi P. aeruginosa er en bevægelig Gram-negative stav, der tilhører klassen af ​​gamma-Proteobacteria i familien Pseudomonadaceae. Den er bevægelig med en unipolær flagel, er i stand til at vokse ved temperaturer på op til 42⁰C og kan vokse i miljøer med sparsom næring. P. aeruginosa er blevet dyrket fra jord, havvand, ferskvand og destilleret vand. P. aeruginosa er ikke en del af den normale mikroflora på slimhinderne hos mink, men undersøgelser har vist, at mink under visse forhold kan bære P. aeruginosa i næsehulen i flere uger uden at udvikle hæmoragisk pneumoni. Bakterien er beskrevet som et patogen både hos planter, forskellige ikke-pattedyr og pattedyr, herunder mennesker. Minker den eneste dyreart, der er kendt for at udvikle smitsom, akut og dødelig pneumoni som følge af infektion med P. aeruginosa. Hos mennesker og andre dyr er bakterien kendt som en opportunistisk patogen, der typisk kræver, at værten er immunkompromitteret eller på anden måde svækket for at kunne etablere en infektion. Blandt andet er P. aeruginosa det vigtigste patogen for patienter, der lider af den arvelige sygdom cystisk fibrose (CF), hvor bakterien forårsager en kronisk infektion. Ræve kan inficeres med P. aeruginosa ved anvendelse af kontaminerede instrumenter i forbindelse med kunstig insemination. Epidemiologi Der er udført epidemiologisk forskning, men epidemiologien er aldrig blevet belyst i detaljer. Udbrud af hæmoragisk pneumoni forårsaget af P. aeruginosa forekommer i Danmark primært fra september til november. Hvorvidt dette sæsonudsving er relateret til faktorer hos mink, som har en meget sæsonbetonet livscyklus, eller den vedrører andre faktorer i miljøet, er ikke afklaret. Der er ikke påvist disponerende virusinfektioner eller andre infektiøse faktorer, som kunne optræde som primære faktorer og eventuelt forklare den sæsonmæssige variation. Mulige faktorer i miljøet kunne have at gøre med sammensætningen af ​​foderet eller vejrforholdene i efteråret med høj luftfugtighed, temperaturer typisk over frysepunktet, men under 15⁰C, og mindre sollys og dermed mindre UV-stråling end på andre tidspunkter af året, hvilket skaber gunstige betingelser for mikroorganismer. Mulige disponerende faktorer hos minken selv kunne være udsving i æøå

1.7 Influenza hos mink

Influenza hos mink af Anne Sofie Hammer, Peder Elbek og Tove Clausen Forekomst og betydning Influenzainfektioner forekommer hos fugle og en række pattedyrarter, herunder mink og mennesker. Mink kan inficeres spontant med human influenza A. Sygdomsvoldende influenza A infektioner er påvist hos mink i mange pelsdyrproducerende lande i de senere år: H1N2 fra svin er beskrevet som årsag til klinisk sygdom på minkgårde i USA i 2010, fugleinfluenza H10N4 er beskrevet som årsag til kliniske sygdomsudbrud på minkgårde i Sverige i 1984, H1N1pdm09 af blandet svine/human oprindelse er beskrevet fra udbrud på minkgårde i Norge og Holland i 2011 og i Danmark i 2010, 2011, 2013 og 2014, svineinfluenza H3N2 er beskrevet fra udbrud i Canada i 2006 og 2010 og i Danmark 2009. Forekomsten af influenza hos mink overvåges ikke, så hyppigheden af udbrud i Danmark er ikke kendt. Morbiditet ved influenzaudbrud er formodentlig omkring 100%, mens mortaliteten varierer fra meget lav (få procent) til høj (20-30%). Ætiologi Influenzavirus tilhører familien Orthomyxoviridae, en famile af negativ-sense, enkeltstrengede RNA-virus med segmenterede genomer. Den infektiøse partikel (virionet) har en pleiomorf, sfæririsk eller filamentøs form og er 80-120 nm i diameter. Til familien hører Influenza A, B og C. Influenza A og B virus klassificeres på baggrund af forskelle i nukleoproteiner og matrixproteiner. Influenza A virus-genomet kan inddeles i 8 segmenter, der hver koder for et enkelt protein (segment 1-6) eller to proteiner (7-8). Influenza A virus inddeles i subtyper baseret på overflade antigenerne (proteiner, der stikker ud fra viruskappe) hemagglutinin (HA) og Neuraminidase (NA). Subtyperne er opkaldt efter de serologiske varianter af H og N antigener. Epidemiologi Vilde fugle er det naturlige reservoir for Influenza A virus. Influenza har spredt sig fra vandfugle og fjerkræ til pattedyr, hvor de har etableret sig som endemiske infektioner hos mennesker, heste og grise. Mink er modtagelige både for influenzasmitte fra vilde fugle og fjerkræ, mennesker og grise. I de fleste tilfælde menes smitten ved udbrud på minkgårde at være foderbåren. Der er beskrevet eksempler, hvor influenzavirus er overført direkte mellem mennesker og mink og mellem vilde fugle og mink. Der er forhold på minkgårde der gør, at det formodentlig sjældent sker i praksis, herunder begrænset kontakt mellem mink og havfugle og begrænset direkte håndtering af minkene. Udbrud af højpatogen H5N1 infektion i vilde fugle i Europa var ledsaget af smitte til vilde rovdyr, herunder en husmår i Tyskland og en amerikansk mink i Sverige, begge i 2006. Begge dyr blev fundet i områder, hvor fugle døde af influenza, og er formodentlig blevet smittet ved at æde af kadavere af døde fugle. Patogenese Influenza replikeres generelt i epitelceller og forårsager en akut infektion, som afsluttes, når værten udvikler et specifikt immunrespons. Patogenesen ved højpatogen H5N1 infektion i rovdyr er undersøgt i katte, ræve og fritter. Foderbåren smitte kan forårsage infektion både ved inhalation af virus til respirationsvejene eller infektion af tarmen. Fra respirationsveje og tarmkanal kan virus spredes til andre organer via blod eller lymfe. Symptomer Udbrud har været karakteriseret af nedsat appetit og pludselige dødsfald, hvor minkene findes døde med blodigt flåd fra snude og mund. I reglen kan der høres spredt nysen og hoste blandt mink i besætningen. Udbrud varer normalt omkring tre uger, hvorefter der ikke længere

1.8 Lopper hos mink

Lopper hos mink af Peder Elbek Pedersen, Tove Clausen og Anne Sofie Hammer Forekomst og betydning Lopper kan være et stort problem på minkfarme. Især hos neonatale hvalpe kan lopper være årsag til alvorlig svækkelse og dødsfald. Hos voksne mink medfører loppeangreb kløe og uro. Bid hos mennesker kan også forårsage kløe og irritation. Lopper er fundet med plasmacytose-virus i sig. Ætiologi og patogenese Lopper hos mink er i reglen egernlopper (Ceratophyllussciurorum), som er redebundne. Det vil sige, at lopperne kun findes på minken, når de skal suge blod. Loppernes udvikling fra æg til larve og puppe foregår i redekassen/halm og varer 2-10 dage. Blodmåltidet er nødvendigt for, at loppen kan formere sig. Figur 1. Egernloppens reproduktionscyklus Afhængigt af temperaturen klækkes æggene efter 2-10 dage. Larverne, der ligner små behårede orme, søger væk fra lyset og gemmer sig i revner og sprækker. Larverne lever af organisk materiale (foder, gødning) og de voksne loppers efterladenskaber. Når at ægget er klækket, går der cirka to uger, hvorefter larven forpupper sig. Hvis forholdene er gunstige, dvs. passende temperatur, fugtighed og tilstedeværelse af værtsdyr, vil den voksne loppe bryde ud af puppen efter en uge. Puppen kan forblive intakt i månedsvis og overleve trods eksempelvis hård frost. Den voksne loppe kan efter klækning leve i op til én måned. Voksne lopper kan overleve frost. Lopper kan overføres til en farm via indkøb af smittede avlsdyr, andre pattedyr, især katte, og fugle, især små fugle (stære og gråspurve), som kommer ind i minkhallerne. Symptomer og patologi Hos neonatale hvalpe kan lopper være årsag til alvorlig svækkelse og dødsfald - anæmi. Hos voksne mink medfører loppeangreb kløe og uro. Bid hos mennesker kan også forårsage kløe og irritation. Figur 2. Talrige egernlopper hos mink. Hos voksne mink medfører loppeangreb kløe og uro. Diagnostik Lopperne kan påvises ved undersøgelse af mink og redehalm. Loppeekskrementer på halm Forebyggelse Forebyggende tiltag bør omfatte god hygiejne: 99% af lopperne er i halmen i redekassen. Lopper kan overleve lang tid i halm. Derfor bør redekasserne tømmes for redemateriale efter pelsning og al gammel halm fjernes. Som minimum skal der foretages en mekanisk rengøring af redekasser, men også gerne vask og/eller brænding af redekassen. Derefter pakkes redekassen med nyt redemateriale, og der foretages forebyggende behandling af redekassen med et egnet loppemiddel både mod voksne lopper og mod larver og æg. Det er vigtigt, at loppebekæmpelse foregår allerede i efteråret, da lopperne kan lægge æg, som kan overvintre. Det vigtigste tidspunkt for loppebekæmpelse er i foråret, før hvalpe fødes. Hvalpe er meget sårbare over for loppeangreb. Det kan også være nødvendigt at behandle med loppemidler på jorden under redekasserne, da loppernes æg kan klækkes her. Behandling Permethrin er godkendt til brug hos mink mod levende voksne lopper i en dosering på 2,5g pr redekasse. Det er vigtigt med korrekt dosering, da permethrin let udvikler resistens. Midlet tåles af nyfødte hvalpe. Diflubenzuron 5% anvendes til forebyggende bekæmpelse af lopper hos mink i en dosering på 2 g pr redekasse. Midlet virker kun på loppernes æg og larver, og det har ingen effekt på voksne lopper. Diflubenzuron 5% er ikke giftigt for nyfødte hvalpe. Permethrin og Diflubenzuron 5% kan med fordel bruges i samspil ved at blande de to præparater sammen. Kan eventuelt blandes i savsmuld, Easystrø eller desinficerende pulver, så det er lettere at fordele pulverne i redekassen. Loppemiddel blandet med savsmuld Permethrin 1,5% Pyrethrin I+II 0,5% er registeret til behandling af flyvende og krybende insekter. Det er ikke registreret til brug hos mink, men kan benyttes hos selv yngre dyr. Det er langtidsvirkende i 3-4 uger. Bendiocarb 1.25% er et middel, som virker mod levende lopper. Midl

1.9 Nekrotiserende pyodermi hos mink

Nekrotiserende pyodermi hos mink af Anne Sofie Hammer, Peder Elbek Pedersen og Tove Clausen Andre anvendte betegnelser FENP, potesår, poteråd, nekrotiserende pododermatitis. Forekomst og betydning I november 2014 er blev der for første gang med sikkerhed påvist udbrud af denne særlige type af hudbetændelse i Danmark. Sygdommen er kendt fra alvorlige udbrud på hollandske og finske minkgårde, hvor den første gang blev påvist i 2007. Sygdommen er i de seneste år også påvist på islandske minkfgårde, og den er også endvidere konstateret på nordamerikanske minkgårde. Sygdommen går under betegnelsen ”face and footrot” (hvilket kan oversættes med ansigts- og poteråd) eller FENP (fur animal epidemic necrotic pyoderma). Navnene hentyder til de alvorlige sår, som ofte kan brede sig hurtigt over ansigts- og poteregionen. Sygdommen spreder sig tilsyneladende både inden for den enkelte besætning og mellem besætninger, hvor den forårsager sår og forøget dødelighed og har udviklet sig til at være et velfærdsmæssigt såvel som et økonomisk problem. Sygdommen forekommer i Finland både hos mink, ræv og mårhund. På grund af manglende effekt af behandlingen er anbefalingen i Finland at aflive mink, der viser symptomer på FENP. Samme anbefaling gives i Holland. I Holland er der set voldsomme udbrud af FENP med store reproduktionsproblemer til følge. Nogle minkgårde har forsøgt total sanering på grund af FENP og reproduktionsproblemer. I Holland anses indkøb af nye avlsdyr for at være en risikofaktor for udbrud. Ætiologi og epidemiologi Forskning tyder på, at sygdommen forårsages af en kombination af faktorer, herunder bakterierne Arcaenobacterium phocae og Streptococcus halichoeri. Undersøgelser af sår tyder på, at de to bakterier er medvirkende årsager til sygdommen, men lidelsen er formodentlig multifaktoriel, og andre faktorer (f.eks. immunitet, genetik og virus) kan vise sig at spille en rolle i forhold til udvikling af sygdommen. Mingårde ser typisk de første udbrud med af FENP efter indkøb af nye avlsdyr, FENP konstateres først hos de indkøbte dyr. Det skyldes måske, at disse indkøbte dyr ikke tidligere har været i kontakt med bakterierne og derfor ikke har et specifikt immunologisk forsvar. Symptomer Man bør fatte mistanke om FENP ved forekomst af hudbetændelse og sår med udsivende betændelsesvæske og usædvanlig placering på kroppen – især omkring øjnene, ved mundvigen og på fødderne. Patologi Karakteristiske fund omfatter områder med hudbetændelse med hævelse, rødme, hårtab og skorpedannelse omkring øjet, i aksil eller på poter. Hudbetændelsen kan udvikle sig til voldsomme dybe sår med betændelse i hovedregionen, mundvigen og i neglerødder og poter. Sårene er usædvanlige, meget alvorlige og dybe med tegn på infektion (hævelse, betændelsesvæske). Øjenbetændelse med pus/betændelsesvæske i og omkring øjne kan være det eneste fund hos nogle dyr. På nogen minkgårde er set forekomst af sår, som ikke vil hele i skulderregionen hos mink i efterårsperioden. Fra nogle besætninger med FENP beskrives øget forekomst af pleurale empyemer. Undersøgelse af mink fra disse minkbesætninger har vist forekomst af jeg ville droppe forekomst af bakterierne Arcaenobacterium phocae og Streptococcus halichoeri i pleuravæsken. Diagnostik Diagnosen stilles ved patologisk undersøgelse, kombineret med påvisning af agens ved dyrkning og sekventering. Differentialdiagnostik Traumatiske sår, fistelkanaler ved tandbylder, sår som følge af bakterie- eller svampeinfektioner. Hvalpesyge. Forebyggelse og behandling Der er ingen kendt effektiv metode til forebyggelse eller bekæmpelse af FENP. Sårene heler typisk dårligt uanset behandling. Samtidig kan dyr med sår udgøre en risiko for videre spredning af bakteriene. Derfor anbefales aflivning af dyr, der er ramt af sygdommen. Efter aflivning rengøres og desinficeres dyrenes bure/redekasser grundigt. Nogle avlere har behandlet meget intensivt (i op til 14 dage) med antibiotika. Behandling bør ske efter bakteri

1.9.1 Parvo virusenteritis hos mink

Parvo virusenteritis hos mink af Anne Sofie Hammer, Peder Elbek Pedersen og Tove Clausen Forekomst og betydning Parvo virusenteritis (MVE) hos mink blev første gang rapporteret fra Canada i 1947, men sygdommen spredte sig hurtigt til andre minkproducerende lande. Det første udbrud på en dansk minkgård blev påvist i 1958. Antallet af registrerede udbrud er faldet i de seneste år fra 19 i 2011 til ingen eller enkelte ganske få i de efterfølgende år. Da der sjældent udføres diagnostiske undersøgelser i forbindelse med mildere udbrud af diarre, og MVE ikke længere er en lovomhandlet sygdom, kan den reelle forekomst dog formodentlig være højere end antallet af registrerede tilfælde. Rapporter vedrørende morbiditet i forbindelse med MVE varierer betydeligt fra 1-50 pct.. Mortaliteten er i dag sædvanligvis lav (1-5 pct.), men kan dog være højere. Udbrud kan blandt andet kompliceres af samtidig forekomst af andre infektionssygdomme (eksempelvis plasmacytose eller bakterielle infektioner), hvilket kan resultere i højere morbiditet og mortalitet. Dødsfald forårsaget af MVE ses især i vækstperioden og skyldes som regel diarré, dehydrering og sekundære bakterieinfektioner. Det er beskrevet, at MVE kan påvirke produktionsresultater, herunder kropsstørrelse og skindkvalitet. Ætiologi Mink virusenteritis virus (MVEV) som er årsag til MVE tilhører familien parvoviridae under genus Parvovirus. et er et lille (25 nm diameter) non-enveloped virus med en isosahedral kapsidstruktur. Genomet er enkeltstrenget DNA på 5 kb, som koder for to strukturelle proteiner og for to non-strukturelle proteiner. MVEV, CPV-2 (canine parvovirus type 2), FPLV (feline panleukopenia-virus) og RPV (racoon parvovirus) fra mårhund er tæt beslægtede. Der er påvist tre forskellige antigene typer af MVEV. I Danmark er foreløbig kun konstateret type 2. Undersøgelser viser, at de kendte typer har så stort antigenfællesskab, at en vaccine lavet af enhver af typerne formodentlig vil give lige stor beskyttelse mod alle typer. MVEV er meget stabil og kan forblive infektiøs i miljøet i op til 9 måneder. MVEV overlever mere end to timer ved 120oC og flere år ved 40o C. MVEV inaktiveres ved høj PH. Patogenese MVEV overføres ved direkte kontakt mellem inficerede dyr eller indirekte kontakt med gødning eller forurenede redskaber. Et enkelt tilfælde af foderbåren smitte er beskrevet. MVEV introduceres oralt, hvorefter den første virusreplikation foregår i lymfoidt væv i oropharynx og tarm. Herfra spredes virus til mesenteriske lymfeknuder, milt og enterocyter i de Lieberkühnske krypter i tyndtarmen. Inficerede krypter undergår nekrose ved frigivelse af virus, hvilket medfører atrofi af villi, kollaps af krypter og deraf følgende malarbsorptions diarre. Produktion af virus starter to dage efter infektion og falder hurtigt igen fire dage efter infektion. Det er som regel kun i perioden 4-6 dage efter infektion, at der udskilles målebare mængder virus med fæces. Fra dag 7 efter infektion er der målelige antistoffer i serum. De første kliniske symptomer med diarre ses fra dag 5 efter infektion. Undersøgelser har vist, at mink, der overlever infektion, kan udskille virus i fæces i to måneder og i nogle tilfælde muligvis op til et år efter infektion. Patologi Den makroskopiske patologi kan være varierende og ofte vildledende. Ofte påvises ved obduktionen kun uspecifikke fund, som eksempelvis tegn på diarre og eventuelt forstørrede lymfeknuder. Hos nogen nogle mink påvises karakteristiske læsioner, herunder blodtilblandet tarmindhold, samt hyperæmi, nekrose og ødem fortrinsvis i den forreste del af tyndtarmen. I nogle tilfælde ses leukopeni som følge af påvirkning af lymfoide organer, herunder mesenteriske lymfeknuder, milt og thymus. De karakteristiske histopatologiske forandringer i tyndtarmen kan i reglen påvises omkring 6-8 dage efter infektion, herunder erosion af slimhinden, villus atrofi, dilatation og kollaps af krypter og nekrose og ballonering af kryptepitel celler. I n

1.9.2 Plasmacytose hos mink

Plasmacytose hos mink af Anne Sofie Hammer, Peder Elbek Pedersen og Tove Clausen Andre anvendte betegnelser UK/US: Aleutian Mink Disease (AMD), Aleutian Disease (AD). Forekomst og betydning Plasmacytose forekommer i alle minkproducerende lande. Sygdommen er associeret med dødsfald, dårlig reproduktion og reduceret pelskvalitet og regnes i dag for at være det vigtigste og mest omkostningsfulde sygdomsproblem i minkproduktion. Plasmacytose er i Danmark en lovomhandlet sygdom (Bekendtgørelse om plasmacytose hos pelsdyr, BEK nr. 1470 af 08/12/2015). Bekæmpelse af plasmacytose på danske minkgårde er baseret på et landsdækkende serologisk overvågningsprogram og sanering af positive minkgårde. Bekæmpelse baseret på test og sanering er foreløbig den eneste metode, der med succes har nedbragt forekomsten af plasmacytose på minkgårde i lokale områder. I Danmark har bekæmpelsesprogrammet siden 1976 reduceret udbredelsen af plasmacytose fra at omfatte 100 pct. af minkgårdene til kun at omfatte en mindre andel af minkgårdene i det nordjyske område. I perioden 2015-2016 har der imidlertid været reintroduktion af virusinfektionen i andre dele af landet (Midtjylland, Fyn og Sjælland). Foderbåren spredning af virus er mistænkt for at være årsag til dette tilbageslag i bekæmpelsen af plasmacytose i Danmark. Ætiologi Plasmacytose er forårsaget af infektion med det persisterende parvovirus Aleutian Mink Disease Virus (AMDV). AMDV opfylder kriterierne for at blive klassificeret som et såkaldt ”langsomt virus”. Sygdom forårsaget af ”langsomme virusinfektioner” er en langsomt fremskridende proces, hvor virus sniger sig ubemærket ind i værten og først aktiveres langt senere (efter måneder eller år). Andre virus, der klassificeres som ”langsomme virus”, er AIDS og Creutzfeldt-Jakob sygdom hos mennesker. Der er påvist varierende virulens hos forskellige serologiske varianter af AMDV, dvs. forskellig evne til at forårsage progredierende sygdom hos ikke-Aleutian genotyper af mink. Mink af Aleutian farvetypen udvikler stort set altid alvorlig progredierende sygdom ved infektion med AMDV uanset virusvariant. Ved infektion af non-Aleutian mink med en højvirulent stamme er der beskrevet tre forskellige sygdomsforløb: progredierende forløb (karakteriseret af høje AMDV antistofniveauer, hypergammaglobulinæmi, typiske patoanatomiske forandringer og normale globulinniveauer), persisterende, men non-progredierende sygdomsforløb (karakteriseret af lave AMDV antistofniveauer, normale globulinniveauer, minken forbliver klinisk rask, og der ses ingen patoanatomiske forandringer) eller non-persisterende sygdomsforløb (virus kan ikke længere påvises, og minken forbliver klinisk rask). Alle mink, der er positive for AMDV antistoffer, kan udgøre et reservoir for virus og en potentiel smittekilde. AMDV kan forårsage klinisk sygdom hos mink og fritter. AMDV forårsager ikke sygdom i hunde, katte, mårhunde og mus, der inokuleres med virus, men væv indsamlet fra eksperimentelt inokulerede dyr er infektivt for mink, hvilket indikerer, at disse arter muligvis under nogen omstændigheder kan fungere som reservoir for AMDV. Tabel 1. Aleutian Mink Disease Virus (AMDV) egenskaber Familie Parvoviridae Appel et al. 1987 Porter and Cho 1980 Genus Amdovirus Virion AMDV er et 23-25 nm stort, ikke-kappebærende icosahedralt DNA virus. Genom Genomet er lineært, enkeltstrenget negative sense på omkring 5 kb. Transmission Horisontal og vertikal Gorham et al. 1964 Kenyon et al. 1963 Inaktivering Plasmacytose virus er generelt modstandsdygtig overfor inaktivering og stabil i miljøet. Virus bliver inaktiveret af 2% eller 0,5M NaOH, O,5N HCl, 0,5% iodine, 0,5% NaOCl og ultraviolet lys. Fenoler og 2% NaOH kan eventuelt anvendes som desinfektionsmidler. Parvovirus er modstandsdygtige over for varmebehandling. Virus bliver inaktiveret ved varmebehandling ved 80oC i 30 minutter og ved højere temperaturer (>85oC) efter omkring 6 minutter. AMDV er stabil ved PH 3. Bur

1.9.3 Rystemink

Rystemink af Anne Sofie Hammer, Peder Elbek Pedersen og Tove Clausen Andre anvendte betegnelser US/UK: Shaking Mink Syndrome (SMS). Forekomst og betydning Denne neurologiske sygdom blev for første gang diagnosticeret hos mink på danske minkgårde i 2000. Året efter blev sygdommen også påvist i Sverige og Finland. Siden 2000 har der været sporadiske udbrud af neurologiske symptomer associeret med sygdomskomplekset på minkgårde i Skandinavien, samt i Canada (der er også set tilfælde på minkgårde i Kina, blandt mink importeret fra Danmark). Rystemink forekommer i reglen spredt rundt i besætningen og med lav morbiditet/mortalitet (i de fleste tilfælde langt mindre end 1 pct. af hvalpene). I 2013-2016 har der været enkelte udbrud med højere morbiditet/mortalitet (1-4 pct. af hvalpene). Sygdommen forekommer normalt kun hos hvalpene og ikke hos avlsdyrene, og ofte er det kun en enkelt hvalp fra et kuld, der har symptomer, mens kuldsøskende er symptomfrie. Sygdommen kan dukke op på en minkgård det ene år og være væk det næste. På andre minkgårde ses tilbagevendende forekomst igennem flere år. Ætiologi og patogenese Eksperimentel inokulation af raske mink med homogenat af hjerne fra rystemink førte til udvikling af samme symptombillede hos de inokulerede hvalpe, hvilket bekræftede, at årsagen til sygdommen er en smitsom sygdom, der inficerer centralnervesystemet (CNS). Astrovirus er siden påvist i hjernemateriale fra rystemink. Astrovirus relateres også til hjernebetændelse hos andre dyrearter og mennesker. Hos både mink, andre husdyr og mennesker er astrovirus kendt som en vigtig årsag til diarre og tarmlidelser. Flere studier har bekræftet, at mink astrovirus er en signifikant risikofaktor for diarre i diegivningsperioden hos mink, og en mink astrovirus påvist hos danske mink er blevet molekylært karakteriseret. Patogenesen er ikke belyst, og det vides ikke, hvordan sygdommen overføres og spreder sig. Ved test af rystemink, som ikke længere har neurologiske symptomer ved pelsning, er hjernevævet fundet negativt for astrovirus, hvilket tyder på, at infektionen ikke er persisterende. Symptomer De karakteristiske kliniske symptomer inkluderer rystelser og stavrende ukoordinerede bevægelser. Dyrene bliver afmagrede, fordi de har svært ved at æde. Karakteristisk viser kun hvalpe symptomer, og typisk forekommer symptomerne sporadisk (spredt i besætningen). Rystemink påvises oftest i sommerperioden. Symptomer kan forekomme allerede fra diegivningsperioden og frem til pelsning. Patologi Der er ikke påvist specifikke makroskopisk synlige forandringer. Dyrene kan findes afmagrede ved obduktion som følge af, at de har haft svært ved at æde (på grund af de neurologiske symptomer). Ved histopatologisk undersøgelse påvises nonsuppurativ encephalomyelitis. Diagnose Diagnosen kan stilles på baggrund af de karakteristiske kliniske symptomer og PCR-undersøgelse af hjernevæv. Differentialdiagnoser Neurologiske symptomer forårsaget af plasmacytose, hvalpesyge, bakteriel CNS infektion, forgiftninger, B1-vitaminmangel. Behandling og forebyggelse Behandling er ikke mulig, og det er ikke muligt at forebygge infektion med vaccination. Rystemink ses med forskellig grad af symptomer. (En vurdering af, om rystemink skal aflives, kan eventuelt baseres på, hvor svære symptomer hvalpen har. Rystemink, som er så påvirkede af sygdommen, at de ikke kan indtage føde eller drikke, skal aflives. Ved mindre grader af symptomer (milde rystelser), er der rapporter om mink, hvor symptomerne langsomt forsvinder efter længere tids intensiv pleje. Disse mink skal fodres og have drikkevand på bunden af buret, da de har svært ved at koordinere bevægelserne, især når de skal æde og drikke ved fodring på toppen af buret. Selvom symptomerne er milde, kræver rystemink øget opmærksomhed og pleje. Er det ikke muligt at give dem den nødvendige ekstra opmærksomhed og pleje, bør rystemink aflives af velfærdsmæssige hensyn. Litteratur Blomström A L, Widen F, Hamme

1.9.4 Salmonellose hos mink

Salmonellose hos mink af Anne Sofie Hammer, Peder Elbek Pedersen og Tove Clausen Forekomst og betydning Mink er særligt følsomme over for salmonellainfektioner i april og maj. De hyppigste patogene salmonellatyper hos mink er Salmonella Dublin (især fra kvæg), S. Typhimurium (især æg og fjerkræ) og S. Enteriditis (især æg). Uden for drægtighedsperioden kan mink huse salmonella uden symptomer. I den det danske foderkontrolprogram, hvor der undersøges råvarer og færdigfoder, findes lejlighedsvist salmonella. Råvarer med salmonella er oftest råt slagteaffald fra svin, kvæg og fjerkræ. Salmonella kan derudover findes i tørre råvarer samt isoleres fra siloer og diverse elementer i fabriksanlæg. Ætiologi og epidemiologi I Danmark har man i 2000 og 2012 registreret større udbrud af S. Dublin infektioner associeret med abort, svag- og dødfødte hvalpe, endometritis og forøget dødelighed blandt minkhunner. I begge tilfælde menes smitten at stamme fra kontamineret foder, der havde været "forurenet" med råt slagteaffald fra kvæg. Ved obduktion ses akut til subakut haemorrhagisk endometritis. Symptomer og patologi Hos drægtige hunmink, der får foder med Salmonella Dublin ses, nedsat appetit, nedstemthed, apati, aborter, svag- og dødfødte hvalpe og forøget dødelighed blandt hunmink. Morbiditet og mortalitet er sædvanligvis høj. Diagnostik Diagnosen stilles på baggrund af bakteriel dyrkning og typebestemmelse. Differentialdagnostik Endometritis associeret med Clostridium limosum har tilsvarende symptomer og sygdomsforløb og er formodentlig den vigtigste differentialdiagnose. Forebyggelse Udbrud forebygges bedst ved at undgå forekomst af salmonella i råvarer. Det er især vigtigt i drægtighedsperioden, hvor hunmink er særligt følsomme over for salmonellainfektioner. Man bør således ikke anvende råt slagteaffald i drægtighedsperioden, i særdeleshed ikke slagteaffald fra kvæg. Der har ikke været tilfælde af persisterende salmonellainfektion på minkgårde efter udbrud. Behandling Antimikrobiel behandling kan muligvis have effekt på hunminkenes overlevelse, men når udbrud konstateres, kan tab som følge af dødsfald og aborter ikke undgås. Resistensundersøgelser udført ved tidligere salmonellainfektioner hos mink viste, at S. Dublin og S. Typhimurium i 100 pct. af isolaterne fra kvæg er følsomme for TMP og sulfa, neomycin og apramycin. Ved fremtidige udbrud bør antimikrobiel behandling vælges på baggrund af isolation af bakterier fra dyr og resistensundersøgelse. Figur 1. Ved obduktion ses akut til subakuthaemorrhagisk endometritis. Litteratur Dietz HH, Chriél M, Andersen TH., Jørgensen JC., Torpdahl M, Pedersen H, Pedersen K. Outbreak of Salmonelladublin-associated abortion in Danish fur farms. Can. Vet. J. 2006. 47(12): 1201-5. Dietz HH, Henriksen P, Clausen TN, Chriél M. A brief compendium of the most commonly encountered diseases in mink and foxes in Denmark. Den Kongelige Veterinær- og Landbohøjskole, København, Danmark. 2006. Munkø B. (Personlig kommunikation). Danish Fur Feed Laboratory Amba, Holstebro Denmark. 2016 Williams DR, Bellhouse R. The prevalence of salmonellas in mink. J. Hyg. (Camb). 1974. 72: 71-8.

1.9.5 Aujezkys sygdom hos mink

Sjældne infektionssygdomme Aujezky’s sygdom hos mink af Anne Sofie Hammer, Peder Elbek Pedersen og Tove Clausen Andre anvendte betegnelser Pseudorabies. Forekomst og betydning Aujezky’s sygdom er ikke påvist hos pelsdyr i Danmark i perioden 1999-2015, men forekommer lejlighedsvist i andre pelsdyrproducerende lande. Sygdommen er senest påvist på minkgårde i Spanien i 2002 og 2007. Ætiologi og epidemiologi Mink smittes med Aujezky’s virus gennem inficerede råvarer, eksempelvis fersk råt kød eller slagteriaffald fra svin. Aujezky’s virus forekommer pt. ikke blandt danske svin. Symptomer Inkubationstiden er få dage. Der er rapporteret om stupor, tremor, dyspnø, ptyalism, og trismo. Nogle dyr findes døde, mens de bider sig i tungen eller bider omkring nettråden. Der kan forekomme lammelse af underkæbe og tunge. Abnorm slikken og kløe ("mad itch") ses primært hos ræv, men kun sjældent hos mink. Hos mindre end 1 pct. af minkene ses automutilation af de bagerste poter, ben eller hale. I slutstadiet ses paralyse og død. Sygdommen angives at være dødelig inden for et døgn efter de første kliniske symptomer. Patogenese Morbiditeten er normalt meget lav, idet ikke alle dyr reagerer på indtagelse af virus. Mortaliteten er 100 pct.. Patologi Hos mink kan der være blødninger i lungerne, der sammenholdt med symptomerne kan minde om botulisme. Ellers er der ingen entydige makroskopiske forandringer. Ved histologisk undersøgelse af væv fra hjernen kan der påvises mononukleære infiltrater i Virchow-Robin rum (udvidelser af rummet omkring arterierne i hjernen), multifokal gliose, neuron degeneration og fagocytose og intranukleære inklusionslegemer. Diagnostik Ved histologisk undersøgelse af væv fra hjernen kan der påvises karakteristiske histopatologiske læsioner. Tilstedeværelse af virus kan bekræftes med specifik PCR eller immunohistokemisk farvning. Differentialdiagnostik Bakteriel meningitis, hvalpesyge, Chastek’s paralyse, rabies og botulisme. Forebyggelse og behandling Der er ingen virksom behandling. Sygdommen forebygges ved at undgå at anvende råvarer forurenet med Aujezky’s virus i minkfoder. Figur 1. Mink inficeret med Aujezky’s virus. Der ses blødninger i lunger (A) og ventriklen (B) og stase i meninges (C). Der er ingen entydige makroskopiske forandringer. Ved histologisk undersøgelse ses mononukleær celleinfiltration i hjernen og neuron degeneration (D-E).Billederne er venligst stillet til rådighed af Mónica López Peña Anatomía Patolóxica Facultade de Veterinaria USC, Lugo, Spain og Ricardo Fernández Antonio NUPEVET La Coruña, Spain. A B C D E F Litteratur Christodoulou T, Tsiroyiannis E, Papadopoulos O, Tsangaris T. An outbreak of Aujeszky's disease in minks. Cornell Vet. 1970. 60(1):65-73. Goto H, Burger D, Gorham J Jr. Quantitative studies of pseudorabies virus in mink, ferrets, rabbits and mice. Nihon Juigaku Zasshi. 1971. 33(3):145-53. Goto H, Gorham JR, Hagen KW. Clinical observation of experimental pseudorabies in mink and ferrets. Nihon Juigaku Zasshi. 1968. 30(5):257-63. Kimman TG, van Oirschot JT. Pathology of Aujeszky's disease in mink. Vet Pathol. 1986. 23(3):303-9. Lapcević E. [Contribution to the knowledge of Aujeszk's disease in minks]. Dtsch Tierarztl Wochenschr. 1964. 71(10):273-5. Marcaccini A, López Peña M, Quiroga MI, Bermúdez R, Nieto JM, Alemañ N. Pseudorabies virus infection in mink: a host-specific pathogenesis. Vet Immunol Immunopathol. 2008. 124(3-4):264-73. Quiroga MI, López-Peña M, Vázquez S, Nieto JM. Distribution of Aujeszky's disease virus in experimentally infected mink (Mustela vison). Dtsch Tierarztl Wochenschr. 1997. 104(4):147-50.

1.9.6 Transmissibel Mink Encephalopati

Transmissibel Mink Encephalopati af Anne Sofie Hammer, Peder Elbek Pedersen, Tove Clausen Andre anvendte betegnelser TME. Forekomst og betydning Transmissibel mink encephalopati (TME) blev første gang beskrevet af Hartsough og Burger i 1965. TME er en sjælden sporadisk forekommende sygdom, der involverer centralnervesystemet hos mink. Sygdommen klassificeres som en transmissibel spongiform encephalopati, der er forårsaget af proteiner, kaldet prioner. Sygdommen har en lang inkubationsperiode og er kun diagnosticeret hos voksne mink. Der er beskrevet op til 40 pct. morbiditet og 100 pct. dødelighed blandt voksne dyr på ramte minkgårde. Sygdommen er ikke påvist i de seneste 10 år og er aldrig påvist i Europa. Ætiologi og patogenese Epidemiologiske undersøgelser tyder på, at årsagen til TME er et prion agens, som kan overføres med foderet. Muligvis stammer smitten fra kvæg. Fodring med råvarer stammende får med scrapie har også været mistænkt for at kunne udløse TME hos mink. Med henblik på at undersøge, om TME er forårsaget af fodring med scrapie-inficerede får, blev der foretaget infektion af mink med 21 forskellige Scrapie stammer: Kun én mink udviklede symptomer, og det blev konkluderet, at TME kunne være forårsaget af en type af scrapie. Prioner er infektiøse agens, der menes at forårsage transmissibel spongiforme encephalopathier (TSE). Prioner består alene af protein. Infektionsforsøg har vist, at inkubationsperioden er lang, og sygdommen er kun påvist hos voksne mink. Patologi Mink med TME har en spongiform encephalopati tilsvarende den, der ses hos scrapie-inficerede får. Sygdommen er karakteriseret ved svampelignende forandringer i hjernevævet. Symptomer TME har et snigende sygdomsforløb, der starter med lette symptomer karakteriseret af ophør af pelspleje og tab af normal adfærd: dyrene efterlader deres gødning i hele buret i stedet for ved enden af buret. Der kan ses hypereksibilitet, besvær med at tygge og sluge, og halerne kan være buet over ryggen som hos et egern. Disse milde symptomer efterfølges af mere alvorlige symptomer, som ataksi og lange perioder med somnolens. I nogle tilfælde kan dyret stå ubevægelig med hovedet i et hjørne af buret. Det kroniske sygdomsforløb ender med døden, hvis ikke minken aflives inden. Diagnostik Den kliniske diagnose bekræftes med påvisning af karakteristisk spongiform encephalopati ved histopatologisk undersøgelse. Der er også udført eksperimentelle smitteforsøg med henblik på at bekræfte smitten. Differentialdiagnostik Sygdommen kan forveksles med andre sygdomme associeret med centralnervøse forstyrrelser, herunder hvalpesyge, rystesyge og plasmacytose. Behandling og forebyggelse Sygdommen kan ikke behandles. Sygdommen forebygges ved ikke at fodre minkene med råvarer, som kan indeholde smitstofferne. I rapporter om tidligere udbrud af TME hos mink er det foreslået, at fodring med selvdøde dyr (kvæg) kan udgøre en risiko. Litteratur Burger D, Hartsough GR. Encephalopathy of mink. II. Experimental and natural transmission. J. Infect. Dis. 1965. 115: 393-9. Hartsough GR, Burger D. Encephalopathy of mink. I. Epizootiologic and Clinical observations. J. Infec. Dis. 1965. 115: 387-92. Marsh RF, Hanson RP. Physical and chemical properties of the transmissible mink encephalopathy agent. J. Virol. 1969. 3: 176-80. Marsh RF, Hanson RP. On the origin of transmissible mink encephalopathy. In Hadlow WJ, Prusiner SP (Eds.), Slow transmissible diseases of the nervous system (Vol. 1). Academic Press, New York. 1979. pp. 451-60. Marsh RF, Hartsough GR. Evidence that transmissible mink encephalopathy results from feeding infected cattle. In Murphy BD, Hunter DB (Eds.), Biology, pathology and genetics of fur bearing animals. Proceedings of the 4th International Scientific Congress in Fur Animal Production. Hudson´s Bay Auction House, Ontario, Canada. 1988. pp. 204-7.

2.1 Kutane svampeinfektioner hos mink

2 Hudsygdomme Kutane svampeinfektioner hos mink af Anne Sofie Hammer, Peder Elbek Pedersen og Tove Clausen Forekomst og betydning Der er meget få tilgængelige beskrivelser af svampeinfektioner hos mink, der omfatter rapporter vedrørende dermatophytosis og candidiasis. Svampeinfektioner diagnosticeres sjældent, men kan være underdiagnosticerede, fordi de ikke påvises med rutinediagnostiske metoder. Ætiologi og patogenese Hudbetændelse forårsaget af infektion med svampe (Trichophytonspp. eller Candidaspp.).Hos andre arter er kutane svampeinfektioner ofte associeret med immunsupression. Det fremgår også af rapporter vedrørende om svampeinfektioner hos mink, at de påvises hos mink bærende Aleutian gener, der er associeret med Chediak Higashi Syndrome (CHS) og mink inficeret med plasmacytose. Hos mink med plasmacytose eller CHS fungerer immunsystemet dårligere end hos andre mink, hvilket er forbundet med øget risiko for svampeinfektioner. Patologi Obduktionsfund inkluderer generaliseret alopeci, pletvis erythem og superficielle erosioner, overfladiske sår og skorpedannelse på huden. De mest alvorlige hudlæsioner findes ofte hos dyr med anden immunsupprimerende sygdom, herunder dyr inficeret med plasmacytose eller grå/blå mink, der bærer Aleutian gener. Symptomer Alopeci (pletvis eller generaliseret). Ved sekundære bakterielle infektioner ses ofte kløe og sårdannelse. Diagnostik Svampeinfektioner bør mistænkes, når der ses dermatitis med alopeci, som ikke responderer på antimikrobiel behandling, og rutinemæssige mikrobiologiske undersøgelser er inkonklusive. Diagnosen kan stilles ved histopatologisk undersøgelse af huden (hematoxylin and eosin og PAS farvninger) og dyrkning på Sabouraud agar. Differentialdiagnostik Andre sygdomme, der forårsager hudforandringer (hvalpesyge og FENP) og hormonelt hårtab hos ældre hunmink. Forebyggelse og behandling Svampeinfektioner forekommer primært hos dyr, der er immunsvækkede af en eller anden grund. Selektion for robuste dyr og bekæmpelse af immunsvækkende sygdomme (som eksempelvis plasmacytose) er med til at forebygge denne type infektioner. Efter diagnosticering af en svampeinfektion kan der behandles individuelt med et svampemiddel. For eksempel Eniconazolholdige midler (Imaverolvet 100mg/ml). En opløsning med 20 ml Imaverol i 1 l varmt vand påsmøres dyret med pensel eller svamp 2 gange ugentlig i 2 uger.) Nogle desinfektionsmidler som for eksempel Virkon S har effekt mod svampe. En overbrusning med en 2% Virkon S opløsning dagligt i 8 dage beskrives at have effekt. Samme middel kan benyttes som desinfektion af bure og redekasser. Figur 1. Obduktionsfund hos hvalpe med svampeinfektioner i huden, kan være karakteriseret af skorpedannelser på snude og poter, hvilket kan forveksles med hvalpesyge. Ved hudforandringer på pote os snude, bør der altid testes for hvalpesyge virus. Figur 2. Hudforandringhosminkhvalpmedsvampeinfektion i huden. Fund inkluderer generaliseret alopeciog skorpedannelse på huden. Udbredte læsioner som hos denne hvalpe forekommer hos immunsupprimerede dyr. Figur 3. Hudforandringerminkmedsvampeinfektion i huden. Fundinkluderer generaliseret alopeci, pletvis erythem og superficielle erosioner, overfladiske sår og skorpedannelse på huden. Udbredte læsioner som hos denne hvalpe forekommer hos immunsupprimerede dyr. Litteratur Bildfell RJ, Hedstrom OR, Dearing PL. Outbreak of dermatophytosis in farmed mink in the USA. Vet Rec. 2004. 155: 746-8. CampoisTG, Zucoloto, AZ, de Almeida Araujo EJ, Svidizinski TI, Almeida RS, da Silva Quirino GF, Harano RM, Conchon-Costa I, Felipe I. Immunological and histopathological characterization of cutaneus candidiasis J Med Microbiol.2015. 64(8):810-7. de Souza Ramos L, Barbedo LS, Braga-Silva LA, dos Santos AL, Pinto MR, Sgarbi DB. Protease and phospholipase activities of Candida spp. isolated from cutaneous candidiasis. Micol. 2015. 32(2):122-5. Elin RJ, Edelin JB, Wolff SM. Infecti

2.2 Pelsgnav hos mink

Pelsgnav hos mink af Anne Sofie Hammer, Peder Elbek Pedersen og Tove Clausen Forekomst og betydning Forekomsten af pelsgnav på danske minkgårde er mindsket i forhold til tidligere, hvilket antages primært at skyldes selektion, øget adgang til halm og burberigelse (hylder og legetøj). Forekomsten af pelsgnav varierer i løbet af produktionsåret. I september-oktober ses primært nakke- og pelsgnav hos hunhvalpe. I oktober og vintermånederne ses også pels- og halegnav både hos hanner og hunner. En stigning af tilfælde kan konstateres i forbindelse med huldstyring, og hvor et vægttab ønskes. Ses hyppigere hos afmagrede mink. I februar-marts ses nakkegnav hos hunmink som følge af, at hannen bider sig fast i nakken på hunminken ved parring. Efter skifte til sommerpels i april forekommer primært pelsgnav på halen hos hanner. Pelsgnav kan skade pelskvaliteten og derved have økonomisk betydning. Ætiologi og patogenese Pelsgnav er betegnelsen for en type af stereotopi, hvor mink gnaver dækhår af egen eller andre minks pels. Mekanismerne, der udløser pelsgnav rettet mod egen pels, kendes ikke. Pelsgnav rettet mod andre menes at kunne henføres til hanminkens seksuelle adfærd. Der er foreslået mange forskellige disponerende årsager til pelsgnav, men kun få er dokumenterede. Undersøgelser har vist, at genetik samt understimulering og kedsomhed spiller en væsentlig rolle. Patologi Der ses alt fra pletvise til mere udbredte områder, hvor dækhårene mangler, og underulden er ujævn. Den hyppigste form for pelsgnav involverer kun halen, dernæst følger gnav i nakken, mens gnav på ryggen er mindst udbredt. Omfanget kan variere fra kun at omfatte de yderste dækhår på halespidsen til at dække hovedparten af minkens krop. Symptomer Pelsgnav foregår typisk i skumringstimerne, hvor minken er aktiv. Minken viser abnorm adfærd, som er karakteriseret ved, at minken bider i egne eller andre minks dækhår. Diagnostik Diagnosen stilles ved påvisning af den unormale stereotype adfærd karakteriseret af, at minken bider i egne eller andre minks dækhår. Hårlaget ser derfor ujævnt ud med stedvist manglende dækhår. Differentialdiagnostik Hudlidelser forbundet med kløe og hårtab, herunder kutane svampeinfektioner, hormonelle lidelser og lopper kan medføre pelsskader, der kan ligne pelsgnav. Forebyggelse Pelsgnav kan reduceres gennem selektion. Hunner og hanner tages ikke med i avl. Hunmink kan benyttes i produktionslinie, men ikke som blivende avlsdyr. Det formodes, at permanent adgang til halm mindsker forekomsten af pelsgnav. Derudover kan berigelse af minkburet med hylder og genstande til at bide i (bidesnor) reducere forekomsten af pelsgnav. I vinterperioden med lav fodertildeling kan problemet med pelsgnav afhjælpes med øget fodermængde. Lange perioder med slanke dyr bør undgås. Det er især vigtigt med foder i skumringstimerne Behandling Pelsgnav hos mink kan ikke behandles. Pelsgnav kan reduceres gennem selektion og anvendelse af burberigelse. Figur 1. Mildt tilfælde af pelsgnav som kun omfatter halespidsen. Figur 1. Pelsgnav på hale og bagkrop. Efter skifte til sommerpels i april, forekommer primært pelsgnav på halen hos hanner. Figur 2. Udbredt pelsgnav på hovedparten af kroppen hos mink. Der ses udbredte områder, hvor dækhårene mangler og underulden er ujævn. Litteratur Hansen SW, Malmkvist J, Houbak B. Pelsgnav: forekomst, tidsmæssig udvikling og årsager. Dansk pelsdyravl. 1997. 60(1): 26-30 Jeppesen Ll, Falkenberg H. Effects of play balls on peltbiting,behavior and level of stress in ranch mink. Scientifur. 1990. 14(3): 179-86. Malmkvist J, Brix B, Henningsen K, Wiborg O. Hippocampal neurogenesis increase with stereotypic behavior in mink (Neovison vison). Behav Brain Res. 2012. 229(2): 359-64. Malmkvist J, Jeppesen L, Palme R. Stress and stereotypic behaviour in mink (Mustela vison): A focus on adrenoco

2.3 Potekallus hos mink

Potekallus hos mink Af Anne Sofie Hammer, Peder Elbek Pedersen og Tove Clausen Forekomst og betydning Potekallus er områder med fortykkelse af huden og dannelse af kallus primært i metatarsalområdet hos mink. Forekomsten varierer mellem minkgårde og farvetyper. Potekallus forekommer langt hyppigere hos hanmink end hunmink. I forbindelse med undersøgelse af poter på fire danske minkgårde, der alle havde en historik vedrørende poteproblemer, blev der påvist varierende grader af potelæsioner hos 44,9 pct. af 1159 undersøgte mink. Læsionerne blev klassificeret som hårtab, fortykket hud (hyperkeratose) eller skorpedannelse. Ætiologi og patogenese Årsagen til udvikling af potekallus hos nogle mink kendes ikke, men den histopatologiske morfologi er forenelige med læsioner opstået som følge af mekanisk påvirkning af huden. Der er ikke påvist sammenhæng mellem minkenes vægt og udvikling af potekallus. Symptomer Typisk ingen. Potekallus opdages i reglen først ved nærmere undersøgelse af poten. I sjældne tilfælde kan opstå halthed og nedsat parringsvillighed ved beskadigelse af meget store kallus. Patologi Forandringer findes hyppigst på bagpoterne og kan beskrives som et cirkulært område lokaliseret til metatarsalområdet (figur 1) proximalt for den store trædepude på bagpoterne. I milde tilfælde ses områder med hårtab og hyperkeratose. Sjældnere ses prominerende kallusdannelser. Ved større prominerende kallusdannelser kan i sjældne tilfælde ses beskadigelse og sårdannelse. Figur 1. Potekallus findes primært i metatarsalområdet. Cirklerne viser placeringen af metacarpalområdet (MC) og metatarsalområdet (MT) hos en mink. Diagnostik Diagnosen kan stilles ved klinisk eller pato-anatomisk undersøgelse. Differentialdiagnostik Kan forveksles med andre typer af lidelser, der giver læsioner på poterne, herunder kutane svampeinfektioner, hvalpesyge og FENP. Behandling og forebyggelse Potekallus har i de fleste tilfælde en mild karakter (ikke behandlingskrævende). Sårdannelser forekommer sjældent. Ved beskadigelse af kallus med sårdannelse kan det være nødvendigt med antimikrobiel behandling for at undgå infektion. Undersøgelser af flere generationer af mink på to minkgårde har dokumenteret, at mink kan være arveligt disponerede for sygdommen. Derfor bør forekomst af potekallus indgå i vurdering og selektion af avlshannerne. Figur 1. Potekallus hos mink. Som på denne mink findes forandringer findes hyppigst på bagpoterne og kan beskrives som et cirkulært område lokaliseret til metatarsalområdet proximalt for den store trædepude på bagpoterne. I milde tilfælde ses områder med hårtab og hyperkeratose. Figur 2. Mink med sår som følge af helt eller delvis afrevet potekallus. Ved større prominerende kallusdannelser kan i sjældne tilfælde ses sådan beskadigelse og sårdannelse. Litteratur Bonde-Jensen N, Lassus MM, Jespersen A, Jensen HE, Hammer AS.Foreløbige resultater fra patologiske undersøgelser af potesår hos farmmink (Neovison vison). Faglig Årsberetning 2012. Kopenhagen Fur. 2013. pp. 145-7. Brøjer C. Pododermatitis in farmed mink in Canada. PhD thesis. University of Guelph, Canada. 2000. pp. 1-108. Jespersen A, Hammer AS, Jensen HE, Bonde-Jensen N, Lassus MM, Agger JF, Larsen PF. Foot Lesions in Farmed Mink (Neovison vison): Pathologic and Epidemiologic Characteristics on 4 Danish Farms.Vet Pathol. 2015. pii: 0300985815600502. [Epub ahead of print].

1 2 3 4 5